Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr01G000098`

Chromosome: Chr01 Coordinates: 1791447-1793741 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr01G000098`
Name	SmilChr01G000098
Description	autophagy-related protein 8i-like
Chromosome / SeqID	Chr01 / NC_080387.1
Coordinates and Strand	1791447 - 1793741 / `+`

ID Mapping

NCBI Gene ID	`LOC131007234`
GeneID	`131007234`
locus_tag	`-`
NCBI Name	`LOC131007234`
Original query	`SmilChr01G000098`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; KEGG smil; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	autophagy-related protein 8i-like
Product	autophagy-related protein 8i-like
Arabidopsis	`AT3G15580` (APG8H) Ubiquitin-like superfamily protein [Source:NCBI gene (formerly Entrezgene);Acc:820798] identity=72.2; qcov=0.878; evalue=4.56e-62; confidence=high
Rice	`Os07g0512200` (Atg8) - identity=53; qcov=0.878; evalue=2.31e-43; confidence=medium
GO	GO:0006995 (cellular response to nitrogen starvation)
KEGG	smil04136 (Autophagy - other - Salvia miltiorrhiza (redroot sage)); smil04145 (Phagocytosis - Salvia miltiorrhiza (redroot sage))
Pfam	PF02991 (ATG8); PF04110 (APG12)
InterPro	-
eggNOG	-
NR	GeneID:131007234

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Cytoplasmic vesicle	细胞质囊泡	0.80000	`XP_057790368.1`
2	Autophagic vesicle	Autophagic vesicle	0.80000	`XP_057790368.1`
3	Autophagosome	Autophagosome	0.80000	`XP_057790368.1`
4	Vacuole	液泡	0.40000	`XP_057790368.1`
5	Nucleus	细胞核	0.20000	`XP_057790368.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr1:1793312`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	B115
`Chr1:1793569`	`C`	`T`	EMS_canonical_SNV	CDS_variant	3	B24,B53,C17

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057790368.1

131 aa

131

ATG8

APG12

PF02991 ATG8 15-118 aa PF04110 APG12 41-118 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057790368.1`	Pfam	`PF02991`	ATG8	Domain	15	118	6.6e-43	145.9	Autophagy protein Atg8 ubiquitin like
`XP_057790368.1`	Pfam	`PF04110`	APG12	Domain	41	118	5.1e-05	24.3	Ubiquitin-like autophagy protein Apg12

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057934385.1
GGCGTGGACTGGTGAATCAGACGATAAGATCCCACAAACACGACACCGTCCTTATTCCAAGTTCCAATTTTTCAATCAATATTTGTTGTTTTATTGTTTTCCATTTTCGGTCGTCTCTCCCCACCAATTCTGAGCGGAAGCATTGCAACATCTAGAGGGATGGGCAAGATGCAGTCTTTCAAGGAACAGTTTTCTTTTGACGAAAGGGCAGAAGAATCACAGGACATCATCGCCAAATATCCCGATCGAGTCCCTGTTGT...

CDS

1 records

Download CDS FASTA

LOC131007234
ATGGGCAAGATGCAGTCTTTCAAGGAACAGTTTTCTTTTGACGAAAGGGCAGAAGAATCACAGGACATCATCGCCAAATATCCCGATCGAGTCCCTGTTGTTGCTGAAAGATATTCTAAGTCCGACCTTCCTGAGATGGAGAAGAGGAAATTCCTGGTACCTCGTGATATGTCGGTTGGCCAATTTATCCACATCTTGGGCGCGAGGCTCCGCCTGACTCCTGGGAAAGCTCTCTTTGTATTCGTCAAGGATACATTACC...

Protein

1 records

Download Protein FASTA

XP_057790368.1
MGKMQSFKEQFSFDERAEESQDIIAKYPDRVPVVAERYSKSDLPEMEKRKFLVPRDMSVGQFIHILGARLRLTPGKALFVFVKDTLPQTTSLIESLYNSSKDEDGFLYMCYSSEKTFGSTHNVMWHELSLG

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser