Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr05G002595`

Chromosome: Chr05 Coordinates: 29180320-29184003 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr05G002595`
Name	SmilChr05G002595
Description	alpha-glucosidase-like
Chromosome / SeqID	Chr05 / NC_080391.1
Coordinates and Strand	29180320 - 29184003 / `+`

ID Mapping

NCBI Gene ID	`LOC131026347`
GeneID	`131026347`
locus_tag	`-`
NCBI Name	`LOC131026347`
Original query	`LOC131026347`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; KEGG smil; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	alpha-glucosidase-like
Product	alpha-glucosidase-like
Arabidopsis	`AT5G11720` (AT5G11720) Glycosyl hydrolases family 31 protein [Source:NCBI gene (formerly Entrezgene);Acc:831044] identity=60.3; qcov=1.02; evalue=0; confidence=high
Rice	`Os06g0675700` - identity=54.3; qcov=0.991; evalue=0; confidence=high
GO	GO:0004553 (hydrolase activity, hydrolyzing O-glycosyl compounds); GO:0005975 (carbohydrate metabolic process); GO:0030246 (carbohydrate binding)
KEGG	smil00052 (Galactose metabolism - Salvia miltiorrhiza (redroot sage)); smil00500 (Starch and sucrose metabolism - Salvia miltiorrhiza (redroot sage)); smil01100 (Metabolic pathways - Salvia miltiorrhiza (redroot sage)); smil01110 (Biosynthesis of secondary metabolites - Salvia miltiorrhiza (redroot sage))
Pfam	PF01055 (Glyco_hydro_31_2nd); PF13802 (Gal_mutarotas_2); PF21365 (Glyco_hydro_31_3rd)
InterPro	-
eggNOG	-
NR	GeneID:131026347

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Secreted	分泌到胞外	1.00000	`XP_057812184.1`
2	Nucleus	细胞核	0.00000	`XP_057812184.1`
3	Chromosome	染色体	0.00000	`XP_057812184.1`
4	Centromere	着丝粒	0.00000	`XP_057812184.1`
5	Chromatin	染色质	0.00000	`XP_057812184.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr5:29180396`	`A`	`AC`	1bp_insertion	frameshift_variant	2	B43,D3
`Chr5:29180396`	`A`	`AC`	1bp_insertion	CDS_variant	2	B43,D3
`Chr5:29180397`	`T`	`TTC`	2bp_insertion	frameshift_variant	3	C3,C44,D5
`Chr5:29180397`	`T`	`TTC`	2bp_insertion	CDS_variant	3	C3,C44,D5
`Chr5:29180398`	`G`	`A`	EMS_canonical_SNV	CDS_variant	2	B43,D3
`Chr5:29180447`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	C82
`Chr5:29180472`	`C`	`T`	EMS_canonical_SNV	CDS_variant	2	B69,B9
`Chr5:29180484`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	A4
`Chr5:29180505`	`CT`	`C`	1bp_deletion	frameshift_variant	30	A10,A14,A25,A9,B111,B123,B130,B133,B138,B36,B41,B45,B62,B71,B81,C1,C17,C27,C47,C5,C51,C53,C57,C6,C64,C65,C66,C86,D3,D5
`Chr5:29180532`	`C`	`T`	EMS_canonical_SNV	CDS_variant	4	C2,C45,C46,C5
`Chr5:29180542`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	B128
`Chr5:29181301`	`CCG`	`C`	2bp_deletion	frameshift_variant	31	A1,A19,A6,B100,B103,B113,B14,B26,B29,B30,B5,B55,B66,B69,B72,B74,B76,B83,B90,B97,C19,C21,C32,C41,C44,C55,C71,C74,C79,C83,D8

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057812184.1

877 aa

438

877

Gal_mutarotas_2

Glyco_hydro_31_2nd

Glyco_hydro_31_3rd

PF13802 Gal_mutarotas_2 93-247 aa PF01055 Glyco_hydro_31_2nd 290-639 aa PF21365 Glyco_hydro_31_3rd 647-736 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057812184.1`	Pfam	`PF13802`	Gal_mutarotas_2	Domain	93	247	8.2e-13	49.7	Glycosyl hydrolase 31 N-terminal galactose mutarotase-like domain
`XP_057812184.1`	Pfam	`PF01055`	Glyco_hydro_31_2nd	Domain	290	639	1.7e-123	412.8	Glycosyl hydrolases family 31 TIM-barrel domain
`XP_057812184.1`	Pfam	`PF21365`	Glyco_hydro_31_3rd	Domain	647	736	1.2e-22	80.9	Glycosyl hydrolase family 31 C-terminal domain

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057956201.1
ATGAAAGCAAATTATAAAAGTCTTCAATTTGTTTTCGTTAGTTTCTTATTTTTATTCGCATCGCCCATTAAAGCAGATGATGAACAAGAACTGATTGCAAATGGGTACAGCGTTCAATCAGTCAACGCCGATTCATCGGGAAAATCGTTGAACGCTATTCTTCAGCTAATCGACGCCAATAATTCCTCCCTTTACGCTCCTCATATTCCTCTCCTCTCCCTCGTAGCCAGCTTGGAAACGAAAGACCGTCTCCGAGTGAC...

CDS

1 records

Download CDS FASTA

LOC131026347
ATGAAAGCAAATTATAAAAGTCTTCAATTTGTTTTCGTTAGTTTCTTATTTTTATTCGCATCGCCCATTAAAGCAGATGATGAACAAGAACTGATTGCAAATGGGTACAGCGTTCAATCAGTCAACGCCGATTCATCGGGAAAATCGTTGAACGCTATTCTTCAGCTAATCGACGCCAATAATTCCTCCCTTTACGCTCCTCATATTCCTCTCCTCTCCCTCGTAGCCAGCTTGGAAACGAAAGACCGTCTCCGAGTGAC...

Protein

1 records

Download Protein FASTA

XP_057812184.1
MKANYKSLQFVFVSFLFLFASPIKADDEQELIANGYSVQSVNADSSGKSLNAILQLIDANNSSLYAPHIPLLSLVASLETKDRLRVTITDANATRWEVPDDILPRPHRPDNHSTPHAPLLSDPSSDLTFTLQNTTPFGFAVGRRGVSGDALFNATPSNNNSWTYLVFTDQYLQLSSSLPTNNASNLYGIGEHTKGSFKLQPGQTLTLWNADIGSLNTDLNLYGSHPFYMDVRPNGITHGVLLLNSNGMDVVYSGDRITYK...

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser