Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr01G003826`

Chromosome: Chr01 Coordinates: 56593990-56598392 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr01G003826`
Name	SmilChr01G003826
Description	probable plastidic glucose transporter 1
Chromosome / SeqID	Chr01 / NC_080387.1
Coordinates and Strand	56593990 - 56598392 / `+`

ID Mapping

NCBI Gene ID	`LOC130995833`
GeneID	`130995833`
locus_tag	`-`
NCBI Name	`LOC130995833`
Original query	`SmilChr01G003826`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	probable plastidic glucose transporter 1
Product	probable plastidic glucose transporter 1
Arabidopsis	`AT1G05030` (AT1G05030) Major facilitator superfamily protein [Source:NCBI gene (formerly Entrezgene);Acc:839340] identity=76.1; qcov=0.855; evalue=0; confidence=high
Rice	`Os09g0394500` - identity=69.7; qcov=0.844; evalue=0; confidence=high
GO	GO:0015149 (hexose transmembrane transporter activity); GO:0015749 (monosaccharide transmembrane transport); GO:0016020 (membrane)
KEGG	-
Pfam	PF00083 (Sugar_tr); PF07690 (MFS_1)
InterPro	-
eggNOG	-
NR	GeneID:130995833

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Chloroplast	叶绿体	1.00000	`XP_057777269.1`
2	Chloroplast membrane	叶绿体膜	1.00000	`XP_057777269.1`
3	Nucleus	细胞核	0.00000	`XP_057777269.1`
4	Chromosome	染色体	0.00000	`XP_057777269.1`
5	Centromere	着丝粒	0.00000	`XP_057777269.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr1:56596623`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	C43
`Chr1:56598068`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	B84

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057777269.1

524 aa

262

524

Sugar_tr

MFS_1

PF00083 Sugar_tr 87-517 aa PF07690 MFS_1 92-441 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057777269.1`	Pfam	`PF00083`	Sugar_tr	Family	87	517	1.4e-100	338.1	Sugar (and other) transporter
`XP_057777269.1`	Pfam	`PF07690`	MFS_1	Family	92	441	1.9e-20	73.8	Major Facilitator Superfamily

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057921286.1
ATATTGTTTAACATTGGTAGGAAATAGAGAATTTGAGAAAACCGTACTCCCTGCTACATTTATTGTACTTTGCAATGAATAGCTACTGATCACTCATCACCGACTCATTCACCTCAACACAAACATCCATTCTTGATTTTTCTTCTCGTGATTCAGATGTTAGGGGCTTCTCCATCTCCATTGCTCTTCACCCCAAGATGTCACCCAATAATTCCCCTCTATCCTTCATCCAACAAATTCAAGAACCCATTTTCTATTTC...

CDS

1 records

Download CDS FASTA

LOC130995833
ATGTTAGGGGCTTCTCCATCTCCATTGCTCTTCACCCCAAGATGTCACCCAATAATTCCCCTCTATCCTTCATCCAACAAATTCAAGAACCCATTTTCTATTTCCTTTTCTCGCTCATTCTCCAACAAGAACTTCAAAATCACCCCTGCGAAGAAGGATCCGGCTCCCGATTTGGGGCCCCACAGCAATAAAATCCTAGATGATGAAAATGGCGGTGAGGAGGTGGATTTTGGGTGGTTGCCTGCATTTCCCCATGTTTT...

Protein

1 records

Download Protein FASTA

XP_057777269.1
MLGASPSPLLFTPRCHPIIPLYPSSNKFKNPFSISFSRSFSNKNFKITPAKKDPAPDLGPHSNKILDDENGGEEVDFGWLPAFPHVLTASMSNFLFGYHIGVMNGPIVSIAKELGFEANSFLEGLVVSIFIGGAFIGSISCGYLVDKLGYCRTFQLVTIPLVLGAIVSAQAHSLEEILFGRFLVGLGIGVNTVLVPIYISEVAPTNFRGLLGTFSQIGTCLGIIVSLFLAIPSENDPHWWRIILYVASVPGIALALGMQF...

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser