Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr02G001178`

Chromosome: Chr02 Coordinates: 21648406-21652033 Strand: - Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr02G001178`
Name	SmilChr02G001178
Description	ATP synthase gamma chain 2, chloroplastic-like
Chromosome / SeqID	Chr02 / NC_080388.1
Coordinates and Strand	21648406 - 21652033 / `-`

ID Mapping

NCBI Gene ID	`LOC131011560`
GeneID	`131011560`
locus_tag	`-`
NCBI Name	`LOC131011560`
Original query	`SmilChr02G001178`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; KEGG smil; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	ATP synthase gamma chain 2, chloroplastic-like
Product	ATP synthase gamma chain 2%2C chloroplastic-like
Arabidopsis	`AT1G15700` (ATPC2) ATPase, F1 complex, gamma subunit protein [Source:NCBI gene (formerly Entrezgene);Acc:838139] identity=67.9; qcov=0.96; evalue=2.4e-175; confidence=high
Rice	`Os07g0513000` (P0580A11.134) - identity=65.2; qcov=0.864; evalue=1.63e-158; confidence=high
GO	GO:0000275 (GO:0000275); GO:0009535 (chloroplast thylakoid membrane); GO:0015986 (proton motive force-driven ATP synthesis); GO:0046933 (proton-transporting ATP synthase activity, rotational mechanism)
KEGG	smil00190 (Oxidative phosphorylation - Salvia miltiorrhiza (redroot sage)); smil00195 (Photosynthesis - Salvia miltiorrhiza (redroot sage)); smil01100 (Metabolic pathways - Salvia miltiorrhiza (redroot sage))
Pfam	PF00231 (ATP-synt)
InterPro	-
eggNOG	-
NR	GeneID:131011560

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Chloroplast	叶绿体	1.00000	`XP_057795313.1`
2	Chloroplast stroma	叶绿体基质	1.00000	`XP_057795313.1`
3	Chloroplast thylakoid	类囊体	0.80000	`XP_057795313.1`
4	Nucleus	细胞核	0.00000	`XP_057795313.1`
5	Chromosome	染色体	0.00000	`XP_057795313.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr2:21650758`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	C54
`Chr2:21650782`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	B127
`Chr2:21650902`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	B107
`Chr2:21651131`	`G`	`A`	EMS_canonical_SNV	CDS_variant	3	B21,B25,B88
`Chr2:21651168`	`C`	`CA`	1bp_insertion	frameshift_variant	95	A1,A13,A14,A18,A2,A23,A25,A4,A5,A7,A8,B1,B10,B100,B104,B105,B106,B11,B111,B114,B117,B124,B125,B128,B131,B132,B133,B136,B14,B15,B17,B20,B25,B26,B30,B31,B32,B35,B4,B44,B45,B47,B51,B55,B59,B6,B64,B65,B66,B69,B78,B82,B86,B9,B90,B92,B98,C15,C19,C2,C20,C25,C29,C3,C30,C31,C33,C35,C37,C4,C41,C42,C46,C50,C53,C55,C56,C57,C63,C65,C66,C67,C7,C70,C71,C72,C73,C74,C78,C8,C81,C86,C9,D1,D7
`Chr2:21651170`	`C`	`CT`	1bp_insertion	frameshift_variant	17	A19,A25,A3,B113,B122,B129,B21,B33,B63,B79,C16,C22,C32,C64,C66,C68,D9
`Chr2:21651177`	`C`	`CA`	1bp_insertion	frameshift_variant	17	A19,A25,A3,B113,B122,B129,B21,B33,B63,B79,C16,C22,C32,C64,C66,C68,D9
`Chr2:21651180`	`AC`	`A`	1bp_deletion	frameshift_variant	92	A1,A13,A14,A18,A2,A23,A25,A4,A5,A7,A8,B1,B10,B100,B104,B105,B106,B11,B111,B114,B117,B124,B125,B128,B131,B132,B133,B136,B14,B15,B17,B20,B25,B26,B30,B31,B32,B4,B44,B45,B47,B51,B55,B59,B6,B64,B65,B66,B69,B78,B82,B86,B9,B90,B92,B98,C15,C19,C2,C20,C25,C29,C3,C30,C31,C33,C35,C37,C4,C42,C46,C50,C53,C55,C56,C57,C63,C65,C67,C7,C70,C71,C72,C73,C74,C78,C8,C81,C86,C9,D1,D7
`Chr2:21651230`	`T`	`TG`	1bp_insertion	frameshift_variant	127	A1,A13,A14,A18,A19,A2,A23,A25,A3,A4,A5,A7,A8,B1,B10,B100,B102,B104,B105,B106,B11,B111,B112,B113,B114,B117,B122,B124,B125,B127,B128,B129,B130,B131,B132,B133,B136,B14,B15,B17,B18,B20,B25,B26,B30,B31,B32,B33,B35,B4,B40,B44,B45,B47,B51,B55,B59,B6,B63,B64,B65,B66,B67,B68,B69,B77,B78,B79,B8,B82,B84,B86,B88,B9,B90,B92,B94,B95,B98,C14,C15,C16,C19,C2,C20,C22,C25,C29,C3,C30,C31,C32,C33,C35,C37,C41,C42,C44,C46,C49,C50,C53,C55,C56,C57,C63,C64,C65,C66,C67,C68,C7,C70,C71,C72,C73,C74,C78,C79,C8,C81,C86,C9,D1,D6,D7,D9
`Chr2:21651363`	`C`	`T`	EMS_canonical_SNV	CDS_variant	2	C32,C68
`Chr2:21651370`	`G`	`A`	EMS_canonical_SNV	CDS_variant	3	B114,B25,B88
`Chr2:21651375`	`G`	`A`	EMS_canonical_SNV	CDS_variant	5	B131,B21,B26,B8,C28

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057795313.1

376 aa

188

376

ATP-synt

PF00231 ATP-synt 53-370 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057795313.1`	Pfam	`PF00231`	ATP-synt	Domain	53	370	5.2e-90	302.7	ATP synthase

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

8 records

Download cDNA FASTA

XR_009097020.1
AACAATAAGCACTAAATACACCGACCGACCAAGACCTTAATTAAACCGGATCTGGAGCGAGAACCGTTTTCTTGGTTCACCAATATCTCAGAACTCATCACCCACTCCGGCGGTGATTCCATCAATTTTCCGGCAATCGGAGTAATATCGTCGCCAGAATAAGCACCTCACACCTATCAACAACTCATTTGTTTCTTCTTCTTCTTCTATGGCCTGTTCCTTTGCTTTTCCGATCAAAAATCATTATAGAAAATTCATAA...

XR_009097021.1
AACAATAAGCACTAAATACACCGACCGACCAAGACCTTAATTAAACCGGATCTGGAGCGAGAACCGTTTTCTTGGTTCACCAATATCTCAGAACTCATCACCCACTCCGGCGGTGATTCCATCAATTTTCCGGCAATCGGAGTAATATCGTCGCCAGAATAAGCACCTCACACCTATCAACAACTCATTTGTTTCTTCTTCTTCTTCTATGGCCTGTTCCTTTGCTTTTCCGATCAAAAATCATTATAGAAAATTCATAA...

CDS

1 records

Download CDS FASTA

LOC131011560
ATGTCTTCTCTTATCTCGTCGACGTCTCTCTCTTCCAACGACTGCGGTTCAATCTCTTTCCATTCTCAGCTCAACCCGTTTCCGTTTCTCGGTCTTTCCCTCTCTTCAAGGCCTCACACCTCTCAGCCACCAAACCCCCCGTTGATTCAAAACGGGCTCCGTCAAATCCGAGAAAGAATGGAGTCCGTGAAGAACACGCAAAAAATCACCGAAGCAATGAAGCTGGTGGCTGCGGCCAAGGTACGGAGAGCTCAAGAAGC...

Protein

1 records

Download Protein FASTA

XP_057795313.1
MSSLISSTSLSSNDCGSISFHSQLNPFPFLGLSLSSRPHTSQPPNPPLIQNGLRQIRERMESVKNTQKITEAMKLVAAAKVRRAQEAVINGRPFAQSLVEMLYSINEQCQLDDVEVPLTAVRPVRRVALIVVTGERGLCGSFNNAILRKAELRIAELRNRGLDCTLISVGKKGNAYFRRRDNVKVDRFVEGDSFPTTKEAQVIADYVFSLFLCEEVDKVELLYTKFVSLIKSDPVVHTLLPLSGEGEAQDVNGRSVDAGD...

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser