Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr02G003891`

Chromosome: Chr02 Coordinates: 60999286-61002831 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr02G003891`
Name	SmilChr02G003891
Description	uncharacterized SmilChr02G003891
Chromosome / SeqID	Chr02 / NC_080388.1
Coordinates and Strand	60999286 - 61002831 / `+`

ID Mapping

NCBI Gene ID	`LOC131010833`
GeneID	`131010833`
locus_tag	`-`
NCBI Name	`LOC131010833`
Original query	`SmilChr02G003891`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	OsSTA34; symbol=OsSTA34; hit=Os01g0772400; species=rice; confidence=high
Product	OsSTA34; symbol=OsSTA34; hit=Os01g0772400; species=rice; confidence=high
Arabidopsis	`AT4G17650` (AT4G17650) Polyketide cyclase / dehydrase and lipid transport protein [Source:NCBI gene (formerly Entrezgene);Acc:827485] identity=54.8; qcov=1.05; evalue=7.67e-90; confidence=high
Rice	`Os01g0772400` (OsSTA34) - identity=76.3; qcov=0.692; evalue=4.03e-100; confidence=high
GO	GO:0006744 (ubiquinone biosynthetic process); GO:0045333 (cellular respiration); GO:0048039 (ubiquinone binding)
KEGG	-
Pfam	PF03364 (Polyketide_cyc)
InterPro	-
eggNOG	-
NR	GeneID:131010833

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Mitochondrion	线粒体	1.00000	`XP_057794482.1`
2	Nucleus	细胞核	0.00000	`XP_057794482.1`
3	Chromosome	染色体	0.00000	`XP_057794482.1`
4	Centromere	着丝粒	0.00000	`XP_057794482.1`
5	Chromatin	染色质	0.00000	`XP_057794482.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr2:60999788`	`T`	`TTG`	2bp_insertion	frameshift_variant	2	C13,C5
`Chr2:60999788`	`T`	`TTG`	2bp_insertion	CDS_variant	2	C13,C5
`Chr2:60999816`	`TA`	`T`	1bp_deletion	frameshift_variant	1	C13
`Chr2:60999816`	`TA`	`T`	1bp_deletion	CDS_variant	1	C13
`Chr2:61000090`	`C`	`T`	EMS_canonical_SNV	CDS_variant	3	B120,B18,B22
`Chr2:61000112`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	B104

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057794482.1

250 aa

125

250

Polyketide_cyc

PF03364 Polyketide_cyc 100-227 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057794482.1`	Pfam	`PF03364`	Polyketide_cyc	Family	100	227	2e-23	83.7	Polyketide cyclase / dehydrase and lipid transport

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057938499.1
CACCGTTCATAAAAACCCCTATTTTGAGAAAATCTTATTTTAATTTTTAGTTGTATTACAAAACAAGAAATTGCAACAGACCATAATTTACAAAAAAAATTCAATTACAATTTGCAAATCAGCCCTAATTTTAGCCCCAATTCGCAACAGAATCGTATCTCGAGATCACATCAGGCAAATTCGATAGGGTTCCAATCGCACAAACAGATAAACTCCTAATCGATTTCTGATCAAATGCCTCCGTTCAATTCCGCACCGAG...

CDS

1 records

Download CDS FASTA

LOC131010833
ATGCCTCCGTTCAATTCCGCACCGAGGGCGCTCGCCCGATTGGTGGCTCTCCGGAATCCATTGCGGCAGCGGACGAGAGACTTTCCTAGCTACAACCAGATTCGGCGTTCGAGGAACATCGCCGGAAATAATGCGTTTTCTTCGGTGGAAAATGGGCGTTACGGGAATTGCAATTCGCTAGGCTGTGCAAATTTATCGCATATTAGTAGTATTGTTCACCAAAAGAGAGGGTTTCTGGGATGCGGTGATGGCGAAGAGGG...

Protein

1 records

Download Protein FASTA

XP_057794482.1
MPPFNSAPRALARLVALRNPLRQRTRDFPSYNQIRRSRNIAGNNAFSSVENGRYGNCNSLGCANLSHISSIVHQKRGFLGCGDGEEGSMLSKVHQERHVMGYSPEQLFNVVAAVDMYEDFLPWCQRSQIICQNPDGSFDAELEIGFKFLVESYTSHVQLTKPKSIKTTSSQTSLFDHLINVWEFSPGPVPGSCNLYFMVDFKFQSPFYRQIANMFFKEVVSRLVSSFNDRCRQIYGPGVQVLENSYEHRT

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser