Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr03G000052`

Chromosome: Chr03 Coordinates: 517600-519550 Strand: - Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr03G000052`
Name	SmilChr03G000052
Description	thioredoxin F-type, chloroplastic-like
Chromosome / SeqID	Chr03 / NC_080389.1
Coordinates and Strand	517600 - 519550 / `-`

ID Mapping

NCBI Gene ID	`LOC131016961`
GeneID	`131016961`
locus_tag	`-`
NCBI Name	`LOC131016961`
Original query	`SmilChr03G000052`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	thioredoxin F-type, chloroplastic-like
Product	thioredoxin F-type%2C chloroplastic-like
Arabidopsis	`AT3G02730` (TRXF1) thioredoxin F-type 1 [Source:NCBI gene (formerly Entrezgene);Acc:821260] identity=66.9; qcov=0.785; evalue=1.29e-62; confidence=high
Rice	`Os01g0913000` (OsTRXh10) - identity=71.8; qcov=0.724; evalue=4.2e-62; confidence=high
GO	-
KEGG	-
Pfam	PF00085 (Thioredoxin)
InterPro	-
eggNOG	-
NR	GeneID:131016961

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Chloroplast	叶绿体	1.00000	`XP_057801787.1`
2	Chloroplast stroma	叶绿体基质	1.00000	`XP_057801787.1`
3	Nucleus	细胞核	0.00000	`XP_057801787.1`
4	Chromosome	染色体	0.00000	`XP_057801787.1`
5	Centromere	着丝粒	0.00000	`XP_057801787.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr3:518027`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	C6
`Chr3:518037`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	B118
`Chr3:518988`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	C43
`Chr3:518998`	`G`	`A`	EMS_canonical_SNV	CDS_variant	3	B5,B57,C46
`Chr3:519033`	`C`	`CTA`	2bp_insertion	frameshift_variant	86	A15,A19,A20,A23,A25,A3,A4,B100,B102,B103,B111,B120,B124,B129,B13,B130,B131,B136,B139,B14,B140,B15,B16,B17,B18,B20,B21,B22,B31,B33,B37,B40,B42,B43,B48,B50,B51,B52,B58,B59,B60,B61,B62,B69,B73,B77,B79,B81,B84,B87,B88,B89,B93,B94,B99,C10,C17,C23,C25,C27,C29,C30,C35,C38,C39,C5,C54,C57,C62,C63,C7,C71,C72,C74,C75,C76,C77,C79,C8,C80,C83,C84,C87,D2,D3,D9
`Chr3:519040`	`C`	`T`	EMS_canonical_SNV	CDS_variant	3	B18,B5,C79
`Chr3:519055`	`G`	`A`	EMS_canonical_SNV	CDS_variant	2	B19,B48
`Chr3:519082`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	B104
`Chr3:519179`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	B140

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057801787.1

181 aa

181

Thioredoxin

PF00085 Thioredoxin 76-173 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057801787.1`	Pfam	`PF00085`	Thioredoxin	Domain	76	173	1.9e-24	86.3	Thioredoxin

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057945804.1
GAATACTATAAAACAAACACCTCATCATTTTTAAGATGAAATCTTCAAATTTTCCTCTTCAATTTTGTGGCAGCAAATCTAGTCCCATTTAGGATTTTTAGCGCCGCAGCCACAAAAATTAGTGGTTAAATGACAAAACACGCCCTAGATATTCGGACAACTAAAAAGATCCCGAGGGTAGTTTCGTCATTTCCCATGCCCCCAAGAAATTAACGGTCCATTTTCGTCGACCCCTCCCCATAAATTCGGCCCTTCATCTA...

CDS

1 records

Download CDS FASTA

LOC131016961
ATGGCGTTGCAAGTATACAGTGCGGTGCCAAGGACCTCAATTGTGCAGAGCTCTTGGCTGCATGGAGTTGCGGCGAAGCAGATCTGCGTGGGGAGCGATTACCCCCAGCTGATGAAGATGAAGGAGAGGAGGCTGAGCTTGAGCGTGGGGGTGAGGTGCAGCTTGGATGTGACTGCGGAGACCGCGGCCGAGGTGGCGGCGGTGGCGGTGGCGGAGGTGGGGAAGGTGACGGATGTTACTAAGGACACCTTCTGGCCCAT...

Protein

1 records

Download Protein FASTA

XP_057801787.1
MALQVYSAVPRTSIVQSSWLHGVAAKQICVGSDYPQLMKMKERRLSLSVGVRCSLDVTAETAAEVAAVAVAEVGKVTDVTKDTFWPIVKAAGDKTVVVDMYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDSKIVKEVTGAKIDNLILAIDAVRSS

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser