Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr03G001206`

Chromosome: Chr03 Coordinates: 13915723-13917553 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr03G001206`
Name	SmilChr03G001206
Description	uncharacterized SmilChr03G001206
Chromosome / SeqID	Chr03 / NC_080389.1
Coordinates and Strand	13915723 - 13917553 / `+`

ID Mapping

NCBI Gene ID	`LOC131018407`
GeneID	`131018407`
locus_tag	`-`
NCBI Name	`LOC131018407`
Original query	`SmilChr03G001206`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	confidence=no_hit
Product	confidence=no_hit
Arabidopsis	`-` -
Rice	`-` -
GO	-
KEGG	-
Pfam	PF20167 (Retrotransp-rel)
InterPro	-
eggNOG	-
NR	GeneID:131018407

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Nucleus	细胞核	1.00000	`XP_057803114.1`
2	Chromosome	染色体	0.20000	`XP_057803114.1`
3	Centromere	着丝粒	0.00000	`XP_057803114.1`
4	Chromatin	染色质	0.00000	`XP_057803114.1`
5	Telomere	端粒	0.00000	`XP_057803114.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr3:13916331`	`GC`	`G`	1bp_deletion	frameshift_variant	43	A10,A13,A7,A9,B1,B105,B106,B121,B139,B20,B29,B30,B34,B48,B61,B63,B72,B8,B83,B86,B87,B99,C11,C13,C17,C21,C23,C27,C29,C30,C33,C36,C39,C4,C45,C51,C65,C69,C70,C71,C80,C85,D5
`Chr3:13916422`	`TG`	`T`	1bp_deletion	frameshift_variant	2	B68,B72
`Chr3:13916422`	`TG`	`T`	1bp_deletion	CDS_variant	2	B68,B72
`Chr3:13916622`	`CTT`	`C`	2bp_deletion	frameshift_variant	6	A22,B82,C31,C34,C63,C67

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057803114.1

570 aa

285

570

Retrotransp-rel

PF20167 Retrotransp-rel 215-384 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057803114.1`	Pfam	`PF20167`	Retrotransp-rel	Domain	215	384	3e-24	86.6	Putative plant retrotransposon-related domain

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057947131.1
ATGGCGTCAGGCAAAAATCTCTCTGATCAATCGGACTCTCAAAATCCCCCAACGTCTAAAGAGGGAACCATCTCTACTCCCTCGATTCATGATGCAGAAGCAGAAAAGGCTCAAGATGTAAACCCTCCTTCTCCTACATTGCTTCAAATCGCTATGAAGATTAGGAAAGACATGTCAGTGACTCTCAAACCTAGAGCTCGTCTGCAATCTTCTGAGTCAAAATCGAAAGGTGATAAGTCACCAAAGGAGAAAGAGACTAT...

CDS

1 records

Download CDS FASTA

LOC131018407
ATGGCGTCAGGCAAAAATCTCTCTGATCAATCGGACTCTCAAAATCCCCCAACGTCTAAAGAGGGAACCATCTCTACTCCCTCGATTCATGATGCAGAAGCAGAAAAGGCTCAAGATGTAAACCCTCCTTCTCCTACATTGCTTCAAATCGCTATGAAGATTAGGAAAGACATGTCAGTGACTCTCAAACCTAGAGCTCGTCTGCAATCTTCTGAGTCAAAATCGAAAGGTGATAAGTCACCAAAGGAGAAAGAGACTAT...

Protein

1 records

Download Protein FASTA

XP_057803114.1
MASGKNLSDQSDSQNPPTSKEGTISTPSIHDAEAEKAQDVNPPSPTLLQIAMKIRKDMSVTLKPRARLQSSESKSKGDKSPKEKETMDDPASSKGVGADKVSKSRKRKSVLSDSSRTRSISPVPKCKISHPPPPKFQKSKNVEKKGVNSRSSKNNQIATGVPLGSGPVFDAHMFRSVIHQKLWKSFNAKTLIPDGALNMKNLLGTGIMDILVKNELANTVRETRPYVHKIVIEFYCNLSEEMFDDCSPNKFKAFVRGPFF...

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser