Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr03G001343`

Chromosome: Chr03 Coordinates: 15693797-15694388 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr03G001343`
Name	SmilChr03G001343
Description	60S ribosomal protein L22-2-like
Chromosome / SeqID	Chr03 / NC_080389.1
Coordinates and Strand	15693797 - 15694388 / `+`

ID Mapping

NCBI Gene ID	`LOC131017834`
GeneID	`131017834`
locus_tag	`-`
NCBI Name	`LOC131017834`
Original query	`SmilChr03G001343`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; KEGG smil; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	60S ribosomal protein L22-2-like
Product	60S ribosomal protein L22-2-like
Arabidopsis	`AT3G05560` (AT3G05560) Ribosomal L22e protein family [Source:NCBI gene (formerly Entrezgene);Acc:819722] identity=83.3; qcov=1; evalue=2.07e-62; confidence=high
Rice	`Os07g0674200` (P0618H09.1) - identity=87.3; qcov=0.873; evalue=1.29e-55; confidence=high
GO	GO:0002181 (cytoplasmic translation); GO:0003723 (RNA binding); GO:0003735 (structural constituent of ribosome); GO:0005840 (ribosome)
KEGG	smil03010 (Ribosome - Salvia miltiorrhiza (redroot sage))
Pfam	PF01776 (Ribosomal_L22e)
InterPro	-
eggNOG	-
NR	GeneID:131017834

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Cytoplasm	细胞质	1.00000	`XP_057802557.1`
2	Nucleus	细胞核	0.60000	`XP_057802557.1`
3	Cytosol	细胞质基质	0.60000	`XP_057802557.1`
4	Nucleolus	核仁	0.20000	`XP_057802557.1`
5	Chromosome	染色体	0.00000	`XP_057802557.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr3:15693876`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	C2

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057802557.1

126 aa

126

Ribosomal_L22e

PF01776 Ribosomal_L22e 16-125 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057802557.1`	Pfam	`PF01776`	Ribosomal_L22e	Family	16	125	7.6e-46	155.7	Ribosomal L22e protein family

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057946574.1
ACACACAGTTCACGCACTCTGCCGTTCCATTCCACAGCTACGAAAAAAAAAACTTCGCGAAGATGAGCAAAGGCACGGCGGCTGCGGCGGCAAAGGGCGGGAAGAAGAAGGGGGTTAGCTTCGTGATCGATTGCTCGAAGCCGGTGGAGGATAAGATCATGGAGATCGCTTCGCTAGAGAAGTTTTTGCAGGAAAGAATAAAGGTCGGCGGCAAAGCTGGTGCTCTCGGCGATTTCGTTACCGTCAGCCGCGACAAGAAC...

CDS

1 records

Download CDS FASTA

LOC131017834
ATGAGCAAAGGCACGGCGGCTGCGGCGGCAAAGGGCGGGAAGAAGAAGGGGGTTAGCTTCGTGATCGATTGCTCGAAGCCGGTGGAGGATAAGATCATGGAGATCGCTTCGCTAGAGAAGTTTTTGCAGGAAAGAATAAAGGTCGGCGGCAAAGCTGGTGCTCTCGGCGATTTCGTTACCGTCAGCCGCGACAAGAACAAGATCACCGTCACCGCGGATTCCACTTTCTCCAAAAGGTATTTGAAGTATTTGACAAAGAA...

Protein

1 records

Download Protein FASTA

XP_057802557.1
MSKGTAAAAAKGGKKKGVSFVIDCSKPVEDKIMEIASLEKFLQERIKVGGKAGALGDFVTVSRDKNKITVTADSTFSKRYLKYLTKKYLKKHNVRDWLRVISSNKERNVYELRYFNIAEQEGEDED

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser