Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr03G001718`

Chromosome: Chr03 Coordinates: 23048437-23049338 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr03G001718`
Name	SmilChr03G001718
Description	brassinosteroid-responsive RING protein 1-like
Chromosome / SeqID	Chr03 / NC_080389.1
Coordinates and Strand	23048437 - 23049338 / `+`

ID Mapping

NCBI Gene ID	`LOC131015632`
GeneID	`131015632`
locus_tag	`-`
NCBI Name	`LOC131015632`
Original query	`SmilChr03G001718`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	brassinosteroid-responsive RING protein 1-like
Product	brassinosteroid-responsive RING protein 1-like
Arabidopsis	`AT3G61460` (BRH1) brassinosteroid-responsive RING-H2 [Source:NCBI gene (formerly Entrezgene);Acc:825319] identity=60.6; qcov=0.976; evalue=4.27e-69; confidence=high
Rice	`Os04g0579200` - identity=49.6; qcov=0.692; evalue=3.12e-31; confidence=medium
GO	GO:0016567 (protein ubiquitination); GO:0061630 (ubiquitin protein ligase activity)
KEGG	-
Pfam	PF00097 (zf-C3HC4); PF13445 (zf-RING_UBOX); PF13639 (zf-RING_2); PF13923 (zf-C3HC4_2); PF14634 (zf-RING_5); PF17123 (zf-RING_11)
InterPro	-
eggNOG	-
NR	GeneID:131015632

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Endoplasmic reticulum	内质网	0.80000	`XP_057800058.1`
2	Endoplasmic reticulum membrane	内质网膜	0.40000	`XP_057800058.1`
3	Endosome	内体	0.40000	`XP_057800058.1`
4	Golgi apparatus	高尔基体	0.20000	`XP_057800058.1`
5	Nucleus	细胞核	0.00000	`XP_057800058.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr3:23048972`	`G`	`A`	EMS_canonical_SNV	CDS_variant	2	A22,C27
`Chr3:23049066`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	C49

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057800058.1

169 aa

169

zf-RING_2

zf-RING_11

zf-RING_UBOX

zf-C3HC4

zf-C3HC4_2

zf-RING_5

PF13639 zf-RING_2 89-133 aa PF17123 zf-RING_11 90-118 aa PF13445 zf-RING_UBOX 90-130 aa PF00097 zf-C3HC4 90-132 aa PF13923 zf-C3HC4_2 90-132 aa PF14634 zf-RING_5 90-134 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057800058.1`	Pfam	`PF13639`	zf-RING_2	Domain	89	133	1.6e-13	51.4	Ring finger domain
`XP_057800058.1`	Pfam	`PF17123`	zf-RING_11	Domain	90	118	2.2e-08	34.3	RING-like zinc finger
`XP_057800058.1`	Pfam	`PF13445`	zf-RING_UBOX	Domain	90	130	1.9e-06	28.5	RING-type zinc-finger
`XP_057800058.1`	Pfam	`PF00097`	zf-C3HC4	Domain	90	132	5.2e-08	33.3	Zinc finger, C3HC4 type (RING finger)
`XP_057800058.1`	Pfam	`PF13923`	zf-C3HC4_2	Domain	90	132	3.3e-07	30.7	Zinc finger, C3HC4 type (RING finger)
`XP_057800058.1`	Pfam	`PF14634`	zf-RING_5	Domain	90	134	1.5e-07	32.0	zinc-RING finger domain

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057944075.1
ATGCCCATTTTCGTCATTTCACCTCACCCCCAACTTCCCCTATATAATCACCCCCACTTCTCCTTCTCCTCTCTCCCGTGCCTTCTCTCTCTCTCTCACACACAACTCAAACCTCCATTTTCATTCACACATTACACGCACTAACAGTAACGCAAAACACCTCCAATTCCGCTCAATTCGCGCTTCAGAATGGGGTTTCCGGTTGGATACACTGATTTATTCCTCCCGAAATTGCTGGTATATTTGCTAACGGTGTTAGG...

CDS

1 records

Download CDS FASTA

LOC131015632
ATGGGGTTTCCGGTTGGATACACTGATTTATTCCTCCCGAAATTGCTGGTATATTTGCTAACGGTGTTAGGATTTGTGCGGAAATTCGTGTACGCTCTTCTATCTCTATTAGGGCTGGGGGATTTCCTGGAGCCGGAAACAGCGTCGTACGCGTCGCGCGAGGAGTCCGGGGCTGAGCCGAGGTCGGTGTCGGCGGCGCTGATTCGGGAGCTGCTGCCGGTGGTGAGGTTCGCGGATTTGGAGGAGGATCTAGACCCGCC...

Protein

1 records

Download Protein FASTA

XP_057800058.1
MGFPVGYTDLFLPKLLVYLLTVLGFVRKFVYALLSLLGLGDFLEPETASYASREESGAEPRSVSAALIRELLPVVRFADLEEDLDPPESCAVCLYEFGGEDEIRRLTNCRHIFHRSCVDRWMDHDQKTCPLCRTQFIPEDMQEAFNERLWLASGISDLYGDYSPITAGL

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser