Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr03G003747`

Chromosome: Chr03 Coordinates: 56532939-56536077 Strand: + Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr03G003747`
Name	SmilChr03G003747
Description	probably inactive receptor-like protein kinase At5g41680
Chromosome / SeqID	Chr03 / NC_080389.1
Coordinates and Strand	56532939 - 56536077 / `+`

ID Mapping

NCBI Gene ID	`LOC131019035`
GeneID	`131019035`
locus_tag	`-`
NCBI Name	`LOC131019035`
Original query	`SmilChr03G003747`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	probably inactive receptor-like protein kinase At5g41680
Product	probably inactive receptor-like protein kinase At5g41680
Arabidopsis	`AT5G41680` (AT5G41680) Protein kinase superfamily protein [Source:NCBI gene (formerly Entrezgene);Acc:834170] identity=40.5; qcov=0.862; evalue=1.79e-49; confidence=medium
Rice	`Os01g0223600` - identity=40.5; qcov=0.901; evalue=7.92e-53; confidence=medium
GO	GO:0004672 (protein kinase activity); GO:0005524 (ATP binding); GO:0006468 (protein phosphorylation)
KEGG	-
Pfam	PF00069 (Pkinase); PF07714 (PK_Tyr_Ser-Thr)
InterPro	-
eggNOG	-
NR	GeneID:131019035

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Cell membrane	细胞膜	1.00000	`XP_057803703.1`
2	Cytosol	细胞质基质	0.60000	`XP_057803703.1`
3	Nucleus	细胞核	0.00000	`XP_057803703.1`
4	Chromosome	染色体	0.00000	`XP_057803703.1`
5	Centromere	着丝粒	0.00000	`XP_057803703.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr3:56532945`	`G`	`A`	EMS_canonical_SNV	CDS_variant	5	B139,C3,C48,C62,D11
`Chr3:56532946`	`C`	`T`	EMS_canonical_SNV	CDS_variant	4	B11,B124,B23,B69
`Chr3:56532953`	`G`	`A`	EMS_canonical_SNV	CDS_variant	3	A1,B123,C70
`Chr3:56532958`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	B1
`Chr3:56532977`	`C`	`T`	EMS_canonical_SNV	CDS_variant	4	B107,B44,B47,C86
`Chr3:56534765`	`C`	`T`	EMS_canonical_SNV	CDS_variant	4	A2,B111,B52,C61
`Chr3:56535068`	`C`	`T`	EMS_canonical_SNV	stop_gained	138	A1,A11,A15,A20,A22,A23,A25,A3,B102,B103,B104,B105,B107,B108,B110,B111,B112,B113,B114,B115,B117,B118,B120,B121,B123,B128,B130,B134,B137,B139,B14,B140,B15,B19,B21,B23,B25,B26,B27,B3,B30,B31,B32,B34,B37,B38,B39,B41,B45,B46,B47,B5,B51,B53,B54,B57,B61,B62,B64,B65,B69,B7,B71,B72,B73,B74,B76,B77,B78,B79,B8,B80,B82,B83,B84,B86,B89,B9,B90,B91,B92,B94,B95,C1,C11,C13,C15,C17,C18,C2,C21,C22,C23,C25,C26,C29,C3,C31,C33,C35,C38,C4,C40,C41,C42,C43,C45,C48,C49,C5,C50,C53,C55,C56,C57,C58,C59,C60,C63,C65,C67,C69,C71,C75,C76,C79,C80,C82,C84,C85,C86,D10,D11,D4,D5,D7,D8,D9
`Chr3:56535099`	`G`	`A`	EMS_canonical_SNV	CDS_variant	1	C79
`Chr3:56535121`	`C`	`T`	EMS_canonical_SNV	CDS_variant	4	B117,B5,B53,B64
`Chr3:56535304`	`T`	`TG`	1bp_insertion	frameshift_variant	5	B28,B97,C28,C40,C9
`Chr3:56535304`	`T`	`TG`	1bp_insertion	CDS_variant	5	B28,B97,C28,C40,C9
`Chr3:56535352`	`C`	`T`	EMS_canonical_SNV	CDS_variant	1	C79

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057803703.1

304 aa

152

304

Pkinase

PK_Tyr_Ser-Thr

PF00069 Pkinase 19-277 aa PF07714 PK_Tyr_Ser-Thr 23-196 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057803703.1`	Pfam	`PF00069`	Pkinase	Domain	19	277	7.2e-17	62.4	Protein kinase domain
`XP_057803703.1`	Pfam	`PF07714`	PK_Tyr_Ser-Thr	Domain	23	196	1.7e-17	64.4	Protein tyrosine and serine/threonine kinase

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057947720.1
ATGGCGGCGGTCCGGCTGACTGCTGCTGTCGGCTGGAGCAGAGAATTGGGGTGTGACAACTGTGCTACGGGAACTAAAGCCGTCATCAAGCTACTGAATACTGTGAAGATAACAGAAGATGAATTCGAGCAGCATATGATTGTCTTGGGAAATTGTGTGCATGAAAATGTGGCAACGCCGAGGGCGCACCGCTTCTCGGAGATGACGAAGCTCATCGTCTATGATTACTATAGCCAAGGAAGTGTGTTTGATATGTTGCA...

CDS

1 records

Download CDS FASTA

LOC131019035
ATGGCGGCGGTCCGGCTGACTGCTGCTGTCGGCTGGAGCAGAGAATTGGGGTGTGACAACTGTGCTACGGGAACTAAAGCCGTCATCAAGCTACTGAATACTGTGAAGATAACAGAAGATGAATTCGAGCAGCATATGATTGTCTTGGGAAATTGTGTGCATGAAAATGTGGCAACGCCGAGGGCGCACCGCTTCTCGGAGATGACGAAGCTCATCGTCTATGATTACTATAGCCAAGGAAGTGTGTTTGATATGTTGCA...

Protein

1 records

Download Protein FASTA

XP_057803703.1
MAAVRLTAAVGWSRELGCDNCATGTKAVIKLLNTVKITEDEFEQHMIVLGNCVHENVATPRAHRFSEMTKLIVYDYYSQGSVFDMLHGGNTNGNRPNWERRVRIAAGAAQGIAHIHTQCGGKLAHGNIKSSNIFVNSQGYGCVCDFGLAGLPGMAAKWWDALEYYTSEHSFKSPSQESDVYSFGMFLVELVTGKLPVLLPYLVNLLCTSEPDTLDFNVFKPSLFADELGSVEMEVGKFPADSDLNSWCVEELRRTLVLAK...

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser