Gene Card

Search by standard ID, NCBI Gene ID, GeneID, locus tag, transcript ID, protein ID, or a manually reviewed literature gene name. The page resolves the query to a Red Sage gene and integrates coordinates, sequences, annotations, subcellular localization, EMS variants, and downloads.

Resolved gene

`SmilChr04G001120`

Chromosome: Chr04 Coordinates: 16252777-16253969 Strand: - Biotype: protein_coding

Basic Information

Standard Gene ID	`SmilChr04G001120`
Name	SmilChr04G001120
Description	non-specific lipid-transfer protein 2-like
Chromosome / SeqID	Chr04 / NC_080390.1
Coordinates and Strand	16252777 - 16253969 / `-`

ID Mapping

NCBI Gene ID	`LOC131019843`
GeneID	`131019843`
locus_tag	`-`
NCBI Name	`LOC131019843`
Original query	`SmilChr04G001120`

Open ID mapping

Functional Annotation

Source	GFF basic annotation; NCBI GO GAF; Pfam-A/HMMER; Arabidopsis/Rice homolog
Description	non-specific lipid-transfer protein 2-like
Product	non-specific lipid-transfer protein 2-like
Arabidopsis	`AT2G38530` (LTP2) lipid transfer protein 2 [Source:NCBI gene (formerly Entrezgene);Acc:818435] identity=48.3; qcov=1.02; evalue=5.57e-27; confidence=medium
Rice	`Os11g0116000` (OsLTP1.12) - identity=61.5; qcov=0.814; evalue=7.86e-34; confidence=medium
GO	GO:0006869 (lipid transport); GO:0008289 (lipid binding); GO:0016020 (membrane)
KEGG	-
Pfam	PF00234 (Tryp_alpha_amyl); PF14368 (LTP_2)
InterPro	-
eggNOG	-
NR	GeneID:131019843

Open annotation module

Subcellular Localization Top 5

Rank	Location	Chinese	Score	Protein ID
1	Secreted	分泌到胞外	1.00000	`XP_057804437.1`
2	Cell wall	细胞壁	0.40000	`XP_057804437.1`
3	Nucleus	细胞核	0.00000	`XP_057804437.1`
4	Chromosome	染色体	0.00000	`XP_057804437.1`
5	Centromere	着丝粒	0.00000	`XP_057804437.1`

Open subcellular search

EMS Mutant Variants

The table shows the first 12 candidate EMS variants for this gene. Open the EMS module for full filtering and downloads.

Position	REF	ALT	Type	Effect	Carriers	Samples
`Chr4:16253612`	`C`	`T`	EMS_canonical_SNV	CDS_variant	4	B48,C21,C37,C48

Open EMS variants

Predicted Protein Domains

Domain results are from the Pfam-A HMM database and HMMER hmmscan; positions are amino-acid coordinates on the corresponding protein sequence.

XP_057804437.1

118 aa

118

LTP_2

Tryp_alpha_amyl

PF14368 LTP_2 14-106 aa PF00234 Tryp_alpha_amyl 31-114 aa

Protein ID	Source	Domain ID	Domain name	Type	Start aa	End aa	E-value	Score	Description
`XP_057804437.1`	Pfam	`PF14368`	LTP_2	Family	14	106	8.7e-10	39.3	Probable lipid transfer
`XP_057804437.1`	Pfam	`PF00234`	Tryp_alpha_amyl	Domain	31	114	8e-17	62.0	Protease inhibitor/seed storage/LTP family

cDNA / CDS / Protein Sequences

Download genomic DNA (gene region only)

Every public gene has transcript sequence from the reference annotation. Protein-coding genes also have CDS and protein sequences. CDS and protein downloads do not apply to noncoding RNA. Version suffixes of original accessions are retained.

cDNA

1 records

Download cDNA FASTA

XM_057948454.1
ACCACGAGCGGTGCACAAAAGCCTAACACGTAACAATTTCCACACACTAATACTGTCACACATTTGAAATTTTTTTATGTTTTATTTTTTTTAACTAAATTACATTTGATTCAATGTGAGGGCCTCAAAATTGGACTTATCCTTCATGAATTTGCACTCCCAATTACACGCAGCATTAATTCCACCCAACTACCTTTTCTATTTCTTTTCCCCAAATAATTCTAACTTTTACTCCAAATTAAATTAAATCGCACCACAAT...

CDS

1 records

Download CDS FASTA

LOC131019843
ATGGCTGCAATGACCAAGGCAATGTGCGTGGCCCTCATCGCCGCCGTGATGGTGGCGGCGGCCGCACCGGGTGCCGAGGCGGCGCTAGGCTGCGGCTCGGTGATCTCATACTTGTCACCGTGCCTCCCATATGTGACCAACAGAGGCCCACTTGGCGGGTGCTGCAATGGAGTTAAGGGACTGTACGGCGCCGCCCGGTCCACCCCCGACCGCCAGGCGGCATGCAACTGCCTGAAATCCCTCGCCGCCACCTCCGGCAA...

Protein

1 records

Download Protein FASTA

XP_057804437.1
MAAMTKAMCVALIAAVMVAAAAPGAEAALGCGSVISYLSPCLPYVTNRGPLGGCCNGVKGLYGAARSTPDRQAACNCLKSLAATSGNINLSKAAGLPKQCNVNIPYQISPSTDCTKVR

Flanking Sequence Downloads

Upstream/downstream length is capped at 10000 bp. Negative-strand genes are reverse-complemented so the exported FASTA follows transcriptional 5′ to 3′ orientation.

Download upstream Download downstream Download upstream + gene + downstream

JBrowse

Open genome browser